PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S07916.10
Common NameJCGZ_25455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NAC
Protein Properties Length: 171aa    MW: 20073.2 Da    PI: 9.8196
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S07916.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.12.1e-5471351128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPt+eelv +yLk+k++  k++l +vi ++d+yk+ePwd++   k+   e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+vl
  Jcr4S07916.10   7 VPPGFRFHPTEEELVGYYLKRKINCLKIDL-DVIIDIDLYKMEPWDIQGrcKLGYdEQTEWYFFSHKDRKYPTGTRTNRATAAGFWKATGRDKAVL 101
                    69****************************.99**************952433323667************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    s k++++g++ktLvfykgrap+g+ktdW+mheyrl
  Jcr4S07916.10 102 S-KNKVIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 135
                    *.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-564142IPR003441NAC domain
PROSITE profilePS5100552.4737164IPR003441NAC domain
PfamPF023652.9E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MEMESCVPPG FRFHPTEEEL VGYYLKRKIN CLKIDLDVII DIDLYKMEPW DIQGRCKLGY  60
DEQTEWYFFS HKDRKYPTGT RTNRATAAGF WKATGRDKAV LSKNKVIGMR KTLVFYKGRA  120
PNGRKTDWIM HEYRLHTAHQ ASFFHLLTTQ IPISQDILSL RQHKIPVSSF A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50213510140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7752940.0KC775294.1 Jatropha curcas NAC transcription factor 016 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065782.11e-103PREDICTED: NAC domain-containing protein 76
SwissprotQ9C8W92e-89NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A067LFR81e-128A0A067LFR8_JATCU; Uncharacterized protein
STRINGPOPTR_0013s11740.16e-92(Populus trichocarpa)
STRINGSolyc06g065410.2.17e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.15e-72vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]